Recombinant Human GUK1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GUK1-5223H |
Product Overview : | GUK1 MS Standard C13 and N15-labeled recombinant protein (NP_000849) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GUK1 guanylate kinase 1 [ Homo sapiens (human) ] |
Official Symbol | GUK1 |
Synonyms | GUK1; guanylate kinase 1; guanylate kinase; GMP kinase; ATP:GMP phosphotransferase; GMK; FLJ42686; FLJ43710; |
Gene ID | 2987 |
mRNA Refseq | NM_000858 |
Protein Refseq | NP_000849 |
MIM | 139270 |
UniProt ID | Q16774 |
◆ Recombinant Proteins | ||
GUK1-3348HF | Recombinant Full Length Human GUK1 Protein, GST-tagged | +Inquiry |
GUK1-13623H | Recombinant Human GUK1, GST-tagged | +Inquiry |
GUK1-29176TH | Recombinant Human GUK1, His-tagged | +Inquiry |
GUK1-4406H | Recombinant Human GUK1 protein, His-SUMO-tagged | +Inquiry |
GUK1-31H | Recombinant Human GUK1 Protein (AA 1-198), N-His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUK1-5674HCL | Recombinant Human GUK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUK1 Products
Required fields are marked with *
My Review for All GUK1 Products
Required fields are marked with *
0
Inquiry Basket