Recombinant Human GUK1 protein, His-SUMO-tagged
Cat.No. : | GUK1-4406H |
Product Overview : | Recombinant Human GUK1 protein(Q16774)(2-197aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-197aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.6 kDa |
AA Sequence : | SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GUK1 guanylate kinase 1 [ Homo sapiens ] |
Official Symbol | GUK1 |
Synonyms | GUK1; guanylate kinase 1; guanylate kinase; GMP kinase; ATP:GMP phosphotransferase; GMK; FLJ42686; FLJ43710; |
Gene ID | 2987 |
mRNA Refseq | NM_000858 |
Protein Refseq | NP_000849 |
MIM | 139270 |
UniProt ID | Q16774 |
◆ Recombinant Proteins | ||
GUK1-29176TH | Recombinant Human GUK1, His-tagged | +Inquiry |
GUK1-4406H | Recombinant Human GUK1 protein, His-SUMO-tagged | +Inquiry |
GUK1-185H | Active Recombinant Human GUK1 protein, His-tagged | +Inquiry |
GUK1-2020R | Recombinant Rhesus monkey GUK1 Protein, His-tagged | +Inquiry |
GUK1-2785H | Recombinant Human Guanylate Kinase 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUK1-5674HCL | Recombinant Human GUK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUK1 Products
Required fields are marked with *
My Review for All GUK1 Products
Required fields are marked with *
0
Inquiry Basket