Recombinant Human HNMT

Cat.No. : HNMT-27547TH
Product Overview : Recombinant full length Human HNMT, expressed in Saccharomyces cerevisiae; amino acids 1-292, 292 amino acids, MWt 33.3 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-292 a.a.
Description : In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKL PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQY PGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWH KETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPAT LKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQ DDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCF IDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Full Length : Full L.
Gene Name HNMT histamine N-methyltransferase [ Homo sapiens ]
Official Symbol HNMT
Synonyms HNMT; histamine N-methyltransferase;
Gene ID 3176
mRNA Refseq NM_001024074
Protein Refseq NP_001019245
MIM 605238
Uniprot ID P50135
Chromosome Location 2q22.1
Pathway Histidine metabolism, organism-specific biosystem; Histidine metabolism, conserved biosystem; histamine degradation, conserved biosystem;
Function histamine N-methyltransferase activity; methyltransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNMT Products

Required fields are marked with *

My Review for All HNMT Products

Required fields are marked with *

0
cart-icon