Recombinant Full Length Human HNMT Protein, GST-tagged
| Cat.No. : | HNMT-3677HF | 
| Product Overview : | Human HNMT full-length ORF ( AAH05907, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 51 amino acids | 
| Description : | In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq | 
| Molecular Mass : | 31.35 kDa | 
| AA Sequence : | MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | HNMT histamine N-methyltransferase [ Homo sapiens ] | 
| Official Symbol | HNMT | 
| Synonyms | HNMT; histamine N-methyltransferase; HMT; HNMT-S1; HNMT-S2; | 
| Gene ID | 3176 | 
| mRNA Refseq | NM_001024074 | 
| Protein Refseq | NP_001019245 | 
| MIM | 605238 | 
| UniProt ID | P50135 | 
| ◆ Recombinant Proteins | ||
| HNMT-27547TH | Recombinant Human HNMT | +Inquiry | 
| HNMT-2533R | Recombinant Rat HNMT Protein, His (Fc)-Avi-tagged | +Inquiry | 
| HNMT-2878R | Recombinant Rat HNMT Protein | +Inquiry | 
| HNMT-1704H | Recombinant Human Histamine N-Methyltransferase, His-tagged | +Inquiry | 
| HNMT-1058Z | Recombinant Zebrafish HNMT | +Inquiry | 
| ◆ Native Proteins | ||
| HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNMT Products
Required fields are marked with *
My Review for All HNMT Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            