Recombinant Full Length Human HNMT Protein, GST-tagged
Cat.No. : | HNMT-3677HF |
Product Overview : | Human HNMT full-length ORF ( AAH05907, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 51 amino acids |
Description : | In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq |
Molecular Mass : | 31.35 kDa |
AA Sequence : | MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HNMT histamine N-methyltransferase [ Homo sapiens ] |
Official Symbol | HNMT |
Synonyms | HNMT; histamine N-methyltransferase; HMT; HNMT-S1; HNMT-S2; |
Gene ID | 3176 |
mRNA Refseq | NM_001024074 |
Protein Refseq | NP_001019245 |
MIM | 605238 |
UniProt ID | P50135 |
◆ Recombinant Proteins | ||
HNMT-1704H | Recombinant Human Histamine N-Methyltransferase, His-tagged | +Inquiry |
HNMT-1937R | Recombinant Rhesus Macaque HNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
Hnmt-4643M | Recombinant Mouse Hnmt protein, His&Myc-tagged | +Inquiry |
HNMT-4898H | Recombinant Human HNMT Protein, GST-tagged | +Inquiry |
HNMT-3677HF | Recombinant Full Length Human HNMT Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNMT Products
Required fields are marked with *
My Review for All HNMT Products
Required fields are marked with *