"HNMT" Related Products

Expand
Expand

Recombinant Human HNMT Protein, GST-tagged

Cat.No. : HNMT-4898H
Product Overview : Human HNMT full-length ORF ( AAH05907, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
Description : In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 31.35 kDa
AA Sequence : MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : HNMT histamine N-methyltransferase [ Homo sapiens ]
Official Symbol : HNMT
Synonyms : HNMT; histamine N-methyltransferase; HMT; HNMT-S1; HNMT-S2;
Gene ID : 3176
mRNA Refseq : NM_001024074
Protein Refseq : NP_001019245
MIM : 605238
UniProt ID : P50135

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.