Recombinant Human HOXA13

Cat.No. : HOXA13-28510TH
Product Overview : Recombinant fragment corresponding to amino acids 208-306 of Human HOXA13 with a N terminal proprietary tag; predicted MWt 36.52 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL
Sequence Similarities : Belongs to the Abd-B homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXA13 homeobox A13 [ Homo sapiens ]
Official Symbol HOXA13
Synonyms HOXA13; homeobox A13; homeo box A13 , HOX1, HOX1J; homeobox protein Hox-A13;
Gene ID 3209
mRNA Refseq NM_000522
Protein Refseq NP_000513
MIM 142959
Uniprot ID P31271
Chromosome Location 7p15.2
Function DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA13 Products

Required fields are marked with *

My Review for All HOXA13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon