Recombinant Human HOXA13
Cat.No. : | HOXA13-28510TH |
Product Overview : | Recombinant fragment corresponding to amino acids 208-306 of Human HOXA13 with a N terminal proprietary tag; predicted MWt 36.52 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL |
Sequence Similarities : | Belongs to the Abd-B homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXA13 homeobox A13 [ Homo sapiens ] |
Official Symbol | HOXA13 |
Synonyms | HOXA13; homeobox A13; homeo box A13 , HOX1, HOX1J; homeobox protein Hox-A13; |
Gene ID | 3209 |
mRNA Refseq | NM_000522 |
Protein Refseq | NP_000513 |
MIM | 142959 |
Uniprot ID | P31271 |
Chromosome Location | 7p15.2 |
Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
HOXA13-28510TH | Recombinant Human HOXA13 | +Inquiry |
HOXA13-4277M | Recombinant Mouse HOXA13 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA13-5715C | Recombinant Chicken HOXA13 | +Inquiry |
HOXA13-01H | Recombinant Human HOXA13 Protein, N-His tagged | +Inquiry |
HOXA13-4942H | Recombinant Human HOXA13 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA13 Products
Required fields are marked with *
My Review for All HOXA13 Products
Required fields are marked with *
0
Inquiry Basket