Recombinant Human HOXA13 Protein, GST-tagged

Cat.No. : HOXA13-4942H
Product Overview : Human HOXA13 partial ORF ( NP_000513, 208 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXA13 homeobox A13 [ Homo sapiens ]
Official Symbol HOXA13
Synonyms HOXA13; homeobox A13; homeo box A13 , HOX1, HOX1J; homeobox protein Hox-A13; homeo box 1J; homeo box A13; homeobox protein HOXA13; homeobox protein Hox-1J; transcription factor HOXA13; HOX1; HOX1J;
Gene ID 3209
mRNA Refseq NM_000522
Protein Refseq NP_000513
MIM 142959
UniProt ID P31271

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA13 Products

Required fields are marked with *

My Review for All HOXA13 Products

Required fields are marked with *

0
cart-icon