Recombinant Human HSD3B2 Protein, GST-tagged
Cat.No. : | HSD3B2-5079H |
Product Overview : | Human HSD3B2 full-length ORF ( NP_000189.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 68.5 kDa |
AA Sequence : | MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ] |
Official Symbol | HSD3B2 |
Synonyms | HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5--> 4-isomerase type 2; 3-beta-HSD II; 3 beta-HSD type II; progesterone reductase; delta 5-delta 4-isomerase type II; 3-beta-HSD adrenal and gonadal type; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; short chain dehydrogenase/reductase family 11E, member 2; 4-isomerase type II; 3 beta-hydroxysteroid dehydrogenase type II, delta 5-delta 4-isomerase type II, 3 beta-HSD type II; HSDB; HSD3B; |
Gene ID | 3284 |
mRNA Refseq | NM_000198 |
Protein Refseq | NP_000189 |
MIM | 613890 |
UniProt ID | P26439 |
◆ Recombinant Proteins | ||
HSD3B2-001H | Recombinant Human HSD3B2 Protein, Myc/DDK-tagged | +Inquiry |
HSD3B2-3883HF | Recombinant Full Length Human HSD3B2 Protein, GST-tagged | +Inquiry |
RFL13310MF | Recombinant Full Length Mouse 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 2(Hsd3B2) Protein, His-Tagged | +Inquiry |
HSD3B2-246HF | Recombinant Full Length Human HSD3B2 Protein | +Inquiry |
HSD3B2-1441HFL | Recombinant Full Length Human HSD3B2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD3B2 Products
Required fields are marked with *
My Review for All HSD3B2 Products
Required fields are marked with *