Recombinant Full Length Human HSD3B2 Protein
Cat.No. : | HSD3B2-246HF |
Product Overview : | Recombinant full length Human HSD3B2 (aa 1-372) with N-terminal proprietary tag, 66.99 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 66.990kDa inclusive of tags |
Protein Length : | 372 amino acids |
AA Sequence : | MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRP ELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIH TACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI YTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKL AEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSAS INEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR DPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLD SRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVT LSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV DRHKETLKSKTQ |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ] |
Official Symbol : | HSD3B2 |
Synonyms : | HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2 |
Gene ID : | 3284 |
mRNA Refseq : | NM_000198 |
Protein Refseq : | NP_000189 |
MIM : | 613890 |
UniProt ID : | P26439 |
Products Types
◆ Recombinant Protein | ||
HSD3B2-1111H | Recombinant Human HSD3B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD3B2-5079H | Recombinant Human HSD3B2 Protein, GST-tagged | +Inquiry |
HSD3B2-4340M | Recombinant Mouse HSD3B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD3B2-001H | Recombinant Human HSD3B2 Protein, Myc/DDK-tagged | +Inquiry |
HSD3B2-002H | Recombinant Human HSD3B2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket