Recombinant Full Length Human HSD3B2 Protein
| Cat.No. : | HSD3B2-246HF |
| Product Overview : | Recombinant full length Human HSD3B2 (aa 1-372) with N-terminal proprietary tag, 66.99 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 372 amino acids |
| Description : | The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 66.990kDa inclusive of tags |
| AA Sequence : | MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRP ELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIH TACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI YTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKL AEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSAS INEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR DPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLD SRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVT LSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV DRHKETLKSKTQ |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ] |
| Official Symbol | HSD3B2 |
| Synonyms | HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2 |
| Gene ID | 3284 |
| mRNA Refseq | NM_000198 |
| Protein Refseq | NP_000189 |
| MIM | 613890 |
| UniProt ID | P26439 |
| ◆ Recombinant Proteins | ||
| HSD3B2-3883HF | Recombinant Full Length Human HSD3B2 Protein, GST-tagged | +Inquiry |
| HSD3B2-29343TH | Recombinant Human HSD3B2 | +Inquiry |
| HSD3B2-3417H | Recombinant Human HSD3B2 protein, His-tagged | +Inquiry |
| HSD3B2-1441HFL | Recombinant Full Length Human HSD3B2 Protein, C-Flag-tagged | +Inquiry |
| HSD3B2-23H | Recombinant Human HSD3B2 protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD3B2 Products
Required fields are marked with *
My Review for All HSD3B2 Products
Required fields are marked with *
