Recombinant Full Length Mouse 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 2(Hsd3B2) Protein, His-Tagged
| Cat.No. : | RFL13310MF |
| Product Overview : | Recombinant Full Length Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2(Hsd3b2) Protein (P26149) (2-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-373) |
| Form : | Lyophilized powder |
| AA Sequence : | PGWSCLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLEG DILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFI FSSSVDVAGPNSYKEIVLNGHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQ TCALRPMCIYGERSPLISNIIIMALKHKGILRSFGKFNTANPVYVGNVAWAHILAARGLR DPKKSPNIQGEFYYISDDTPHQSFDDISYTLSKEWGFCLDSSWSLPVPLLYWLAFLLETV SFLLSPIYRYIPPFNRHLVTLSGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Hsd3b2 |
| Synonyms | Hsd3b2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; |
| UniProt ID | P26149 |
| ◆ Recombinant Proteins | ||
| RFL1053HF | Recombinant Full Length Human 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 2(Hsd3B2) Protein, His-Tagged | +Inquiry |
| HSD3B2-3417H | Recombinant Human HSD3B2 protein, His-tagged | +Inquiry |
| HSD3B2-23H | Recombinant Human HSD3B2 protein, Myc/DDK-tagged | +Inquiry |
| HSD3B2-5079H | Recombinant Human HSD3B2 Protein, GST-tagged | +Inquiry |
| HSD3B2-7883M | Recombinant Mouse HSD3B2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hsd3b2 Products
Required fields are marked with *
My Review for All Hsd3b2 Products
Required fields are marked with *



