Recombinant Human IFNA2
Cat.No. : | IFNA2-24H |
Product Overview : | Recombinant Human Albumin/HSA fusion Interferon α-2b produced in P. pastoris is a single non-glycosylated polypeptide chain with a molecular mass of 85.7 kD. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | P.pastoris |
Tag : | Non |
Description : | At least 23 different variants of Interferon-α are known. The individual proteins have molecular masses between 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-α subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Molecular Mass : | 85.7 kD |
AA Sequence : | DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS LHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDN EETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAK QRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADL AKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDV FLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQ NCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSV VLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKE RQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFN LFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYL KEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 98% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IFNA2 interferon, alpha 2 [ Homo sapiens ] |
Official Symbol | IFNA2 |
Synonyms | IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765; |
Gene ID | 3440 |
mRNA Refseq | NM_000605 |
Protein Refseq | NP_000596 |
MIM | 147562 |
UniProt ID | P01563 |
Chromosome Location | 9p22 |
Pathway | Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; |
Function | cytokine activity; interferon-alpha/beta receptor binding; protein binding; |
◆ Recombinant Proteins | ||
IFNA2-0584H | Recombinant Human IFNA2 Protein (Cys24-Glu188), Tag Free | +Inquiry |
IFNA2-1913HFL | Recombinant Full Length Human IFNA2 Protein, C-Flag-tagged | +Inquiry |
IFNA2-222H | Recombinant Human IFNA2, StrepII-tagged | +Inquiry |
Ifna2-977M | Recombinant Mouse Ifna2 Protein, His-tagged | +Inquiry |
IFNA2-382I | Active Recombinant Human IFNA2A Protein (165 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA2 Products
Required fields are marked with *
My Review for All IFNA2 Products
Required fields are marked with *
0
Inquiry Basket