Recombinant Human IFNA2

• Cat.No.: IFNA2-24H
• Product Overview: Recombinant Human Albumin/HSA fusion Interferon α-2b produced in P. pastoris is a single non-glycosylated polypeptide chain with a molecular mass of 85.7 kD.

Specification

• Species: Human
• Source: P.pastoris
• Tag: Non
• Description: At least 23 different variants of Interferon-α are known. The individual proteins have molecular masses between 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-α subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Molecular Mass: 85.7 kD
• AA Sequence: DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS LHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDN EETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAK QRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADL AKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDV FLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQ NCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSV VLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKE RQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFN LFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYL KEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 98% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: IFNA2 interferon, alpha 2 [ Homo sapiens ]
• Official Symbol: IFNA2
• Synonyms: IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765
• Gene ID: 3440
• mRNA Refseq: NM_000605
• Protein Refseq: NP_000596
• MIM: 147562
• UniProt ID: P01563
• Chromosome Location: 9p22
• Pathway: Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem
• Function: cytokine activity; interferon-alpha/beta receptor binding; protein binding