Recombinant Human IFNE protein, GST-tagged
Cat.No. : | IFNE-53H |
Product Overview : | Recombinant Human IFNE(1 a.a. - 208 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 208 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 50.8 Kda |
AA Sequence : | MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKG HTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRR IHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | IFNE interferon, epsilon [ Homo sapiens ] |
Official Symbol | IFNE |
Synonyms | IFNE; interferon, epsilon; interferon epsilon; IFNE1; IFN-epsilon; interferon tau-1; interferon-epsilon; interferon epsilon 1; interferon epsilon-1; IFN-E; IFNT1; PRO655; MGC119018; MGC119020; |
Gene ID | 338376 |
mRNA Refseq | NM_176891 |
Protein Refseq | NP_795372 |
MIM | 615223 |
UniProt ID | Q86WN2 |
Chromosome Location | 9p21.1 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem; |
Function | cytokine activity; cytokine receptor binding; |
◆ Recombinant Proteins | ||
IFNE-53H | Recombinant Human IFNE protein, GST-tagged | +Inquiry |
IFNE-52H | Recombinant Human IFNE protein, His/T7-tagged | +Inquiry |
IFNE-4603H | Recombinant Human IFNE protein, His-tagged | +Inquiry |
IFNE-4444M | Recombinant Mouse IFNE Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNE-1688M | Recombinant Mouse IFNE Protein (22-192 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNE-5278HCL | Recombinant Human IFNE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNE Products
Required fields are marked with *
My Review for All IFNE Products
Required fields are marked with *
0
Inquiry Basket