Recombinant Mouse IFNE Protein (22-192 aa), His-tagged
Cat.No. : | IFNE-1688M |
Product Overview : | Recombinant Mouse IFNE Protein (22-192 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 22-192 aa |
Description : | Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.0 kDa |
AA Sequence : | LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Ifne interferon epsilon [ Mus musculus ] |
Official Symbol | IFNE |
Synonyms | IFNE; IFN-epsilon; Ifne1; Ifnt1; Infe1; Ifn-tau-1; RP23-400P11.1; MGC129462; MGC129463; |
Gene ID | 230405 |
mRNA Refseq | NM_177348 |
Protein Refseq | NP_796322 |
UniProt ID | Q80ZF2 |
◆ Recombinant Proteins | ||
IFNE-53H | Recombinant Human IFNE protein, GST-tagged | +Inquiry |
IFNE-619HF | Recombinant Full Length Human IFNE Protein, GST-tagged | +Inquiry |
IFNE-4444M | Recombinant Mouse IFNE Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNE-083H | Active Recombinant Human IFNE Protein | +Inquiry |
IFNE-4603H | Recombinant Human IFNE protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNE-5278HCL | Recombinant Human IFNE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNE Products
Required fields are marked with *
My Review for All IFNE Products
Required fields are marked with *