Recombinant Mouse IFNE Protein (22-192 aa), His-tagged

• Cat.No.: IFNE-1688M
• Product Overview: Recombinant Mouse IFNE Protein (22-192 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 22-192 aa
• Description: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.0 kDa
• AA Sequence: LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Ifne interferon epsilon [ Mus musculus ]
• Official Symbol: IFNE
• Synonyms: IFNE; IFN-epsilon; Ifne1; Ifnt1; Infe1; Ifn-tau-1; RP23-400P11.1; MGC129462; MGC129463
• Gene ID: 230405
• mRNA Refseq: NM_177348
• Protein Refseq: NP_796322
• UniProt ID: Q80ZF2