Recombinant Human IFNG Protein
Cat.No. : | IFNG-78H |
Product Overview : | IFNG was produced in E. coli cells transformed with human IFNG gene. This product is sterile and does not contain any components of animal origin. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. |
AA Sequence : | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG |
Purity : | > 95% by SDS-PAGE |
Quality Control Test : | Verified by Mass Spectrometry analysis. |
Storage : | Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | Sterile filtered through a 0.2 micron filter in 50% glycerol, 10 mM Phosphate buffer at pH 7.4, 200 |
Gene Name | IFNG interferon, gamma [ Homo sapiens (human) ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI |
Gene ID | 3458 |
mRNA Refseq | NM_000619 |
Protein Refseq | NP_000610 |
MIM | 147570 |
UniProt ID | P01579 |
◆ Recombinant Proteins | ||
Ifng-549R | Recombinant Rat Ifng protein, His-tagged | +Inquiry |
IFNG-21H | Active Recombinant Human IFNG Protein, Animal Free | +Inquiry |
IFNG-2508H | Recombinant Human IFNG Protein (Gln24-Gly161), N-His tagged | +Inquiry |
IFNG-473H | Active Recombinant Human IFNG, Met-tagged | +Inquiry |
IFNG-685H | Recombinant Human Interferon, Gamma, HQ-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *