Recombinant Human IGFBP7 protein
Cat.No. : | IGFBP7-208H |
Product Overview : | Recombinant Human IGFBP7 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 256 |
Description : | This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.6, 150 mM NaCl. |
Bio-activity : | Testing in Progress. |
Molecular Mass : | Approximately 26.4 kDa, a single non-glycosylated polypeptide chain containing 256 amino acids. |
AA Sequence : | SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL |
Endotoxin : | Less than 0.1 EU/μg of rHuIGF-BP7 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IGFBP7 |
Official Symbol | IGFBP7 |
Synonyms | IGFBP7; insulin-like growth factor binding protein 7; insulin-like growth factor-binding protein 7; FSTL2; IGFBP 7; MAC25; PSF; IGFBP-rP1; angiomodulin; IGF-binding protein 7; PGI2-stimulating factor; tumor-derived adhesion factor; prostacyclin-stimulating factor; AGM; TAF; IBP-7; IGFBP-7; RAMSVPS; IGFBP-7v; IGFBPRP1; |
Gene ID | 3490 |
mRNA Refseq | NM_001253835 |
Protein Refseq | NP_001240764 |
MIM | 602867 |
UniProt ID | Q16270 |
◆ Recombinant Proteins | ||
IGFBP7-1604H | Active Recombinant Human IGFBP7 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IGFBP7-12177Z | Recombinant Zebrafish IGFBP7 | +Inquiry |
IGFBP7-2949H | Recombinant Human IGFBP7 Protein (Gly130-Ala280), N-His tagged | +Inquiry |
IGFBP7-1605H | Active Recombinant Human IGFBP7 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
IGFBP7-2281H | Recombinant Human IGFBP7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP7-1694HCL | Recombinant Human IGFBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP7 Products
Required fields are marked with *
My Review for All IGFBP7 Products
Required fields are marked with *
0
Inquiry Basket