Active Recombinant Human IL33 Protein (159 aa)
Cat.No. : | IL33-095I |
Product Overview : | Recombinant Human IL33 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 159 |
Description : | IL33, also known as NFHEV and DVS 27, is a 30 kDa proinflammatory protein that may also regulate gene transcription. IL33 is constitutively expressed in smooth muscle and airway epithelia. It is upregulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL1α or IL1β stimulation. IL-33 shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of murine D10S cells is ≤0.05 ng/mL, corresponding to a specific activity of ≥2 × 10^7units/mg. |
Molecular Mass : | Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids. |
AA Sequence : | MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
Endotoxin : | Less than 1 EU/mg of rHuIL-33 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, 150mM NaCl, 1mM EDTA, 2mM β-Mercaptoethanol, pH7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL33 interleukin 33 [ Homo sapiens ] |
Official Symbol | IL33 |
Synonyms | IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2; |
Gene ID | 90865 |
mRNA Refseq | NM_001199640 |
Protein Refseq | NP_001186569 |
MIM | 608678 |
UniProt ID | O95760 |
◆ Recombinant Proteins | ||
IL33-110H | Recombinant Human IL33 Protein | +Inquiry |
IL33-3045R | Recombinant Rat IL33 Protein | +Inquiry |
IL33-3829D | Recombinant Dog IL33 protein(102-263aa), His-tagged | +Inquiry |
IL33-45H | Recombinant Human IL33 Protein, N-Avi tagged, Biotinylated | +Inquiry |
IL33-2897H | Recombinant Human IL33 Protein (Ser112-Thr270), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *
0
Inquiry Basket