Recombinant Human IL3RA
Cat.No. : | IL3RA-440H |
Product Overview : | Human IL3RA full-length ORF (NP_002174.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ] |
Official Symbol | IL3RA |
Synonyms | IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra |
Gene ID | 3563 |
mRNA Refseq | NM_002183 |
Protein Refseq | NP_002174 |
MIM | 308385 |
UniProt ID | P26951 |
◆ Recombinant Proteins | ||
IL3RA-1120H | Recombinant Human IL3RA Protein (Met1-Arg305), HlgG1 Fc-tagged | +Inquiry |
Il3ra-8312M | Recombinant Mouse Il3ra | +Inquiry |
Il3ra-5661MA | Recombinant Mouse Il3ra protein, Fc-tagged, APC labeled | +Inquiry |
IL3RA-1558R | Recombinant Rhesus Monkey IL3RA Protein, hIgG4-tagged | +Inquiry |
IL3RA-1556R | Recombinant Rhesus Monkey IL3RA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3RA-742CCL | Recombinant Canine IL3RA cell lysate | +Inquiry |
IL3RA-2433HCL | Recombinant Human IL3RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3RA Products
Required fields are marked with *
My Review for All IL3RA Products
Required fields are marked with *