"IL3RA" Related Products

Recombinant Human IL3RA Protein, His/Flag/StrepII-tagged

Cat.No.: IL3RA-5184H
Product Overview: Purified IL3RA (NP_002174.1, 19 a.a. - 305 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Description: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. [provided by RefSeq
Source: Human cells
Species: Human
Tag : His/Flag/StrepII
Form: Liquid
Bio-activity: Not Tested
Molecular Mass: 34.65 kDa
AA Sequence: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Applications: Western Blot
Enzyme-linked Immunoabsorbent Assay
SDS-PAGE
Protein Interaction
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration: ≥ 10 μg/mL
Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Gene Name: IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
Official Symbol: IL3RA
Synonyms: IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra; MGC34174;
Gene ID: 3563
mRNA Refseq: NM_002183
Protein Refseq: NP_002174
MIM: 308385
UniProt ID: P26951

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.