Active Recombinant Human IL9 Protein
Cat.No. : | IL9-230I |
Product Overview : | Recombinant Human IL9 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 1 ng/mL, measured in a cell proliferation assay using MO7e cells, corresponding to a specific activity of > 1 × 10^6 units/mg. |
Molecular Mass : | 25-40 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL9 interleukin 9 [ Homo sapiens ] |
Official Symbol | IL9 |
Synonyms | IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9; |
Gene ID | 3578 |
mRNA Refseq | NM_000590 |
Protein Refseq | NP_000581 |
MIM | 146931 |
UniProt ID | P15248 |
◆ Recombinant Proteins | ||
Il9-119M | Active Recombinant Mouse Il9 Protein | +Inquiry |
IL9-8181M | Recombinant Mouse IL9 Protein | +Inquiry |
Il9-078M | Recombinant Mouse interleukin 9 Protein, His&Flag tagged | +Inquiry |
Il9-2175M | Recombinant Mouse Il9 Protein | +Inquiry |
IL9-28162TH | Recombinant Human IL9, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL9 Products
Required fields are marked with *
My Review for All IL9 Products
Required fields are marked with *
0
Inquiry Basket