Active Recombinant Mouse Il9 Protein
Cat.No. : | Il9-119M |
Product Overview : | Purified recombinant protein of Mouse interleukin 9 (Il9) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Supports IL-2 independent and IL-4 independent growth of helper T-cells. |
Bio-activity : | The ED50 as determined by the dose-dependent proliferation of human MO7e cells is > 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTMSFLKSLLGTFQKTEMQRQKSRP |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il9 interleukin 9 [ Mus musculus (house mouse) ] |
Official Symbol | Il9 |
Synonyms | Il9; interleukin 9; P40; Il-9; interleukin-9; T-cell growth factor P40; cytokine P40 |
Gene ID | 16198 |
mRNA Refseq | NM_008373 |
Protein Refseq | NP_032399 |
UniProt ID | P15247 |
◆ Recombinant Proteins | ||
Il9-1060R | Recombinant Rat Il9 Protein, His-tagged | +Inquiry |
IL9-4291H | Recombinant Human IL9 Protein (Met1-Ile144), C-His tagged | +Inquiry |
IL9-3566H | Recombinant Human IL9 protein, His-SUMO-tagged | +Inquiry |
IL9-5704HF | Recombinant Full Length Human IL9 Protein, GST-tagged | +Inquiry |
Il9-1685R | Recombinant Rat Il9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il9 Products
Required fields are marked with *
My Review for All Il9 Products
Required fields are marked with *
0
Inquiry Basket