"JUN" Related Products

Expand
Expand

Recombinant Human JUN protein, GST-tagged

Cat.No.: JUN-18H
Product Overview: Recombinant Human JUN(1 a.a. - 331 a.a) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 62.1 kDa
AA Sequence: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: JUN jun proto-oncogene [ Homo sapiens ]
Official Symbol: JUN
Synonyms: JUN; jun proto-oncogene; jun oncogene , v jun avian sarcoma virus 17 oncogene homolog , v jun sarcoma virus 17 oncogene homolog (avian); transcription factor AP-1; AP 1; c Jun; p39; jun oncogene; activator protein 1; proto-oncogene c-Jun; enhancer-binding protein AP1; Jun activation domain binding protein; v-jun sarcoma virus 17 oncogene homolog; v-jun avian sarcoma virus 17 oncogene homolog; AP1; AP-1; c-Jun;
Gene ID: 3725
mRNA Refseq: NM_002228
Protein Refseq: NP_002219
MIM: 165160
UniProt ID: P05412
Chromosome Location: 1p32-p31
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Amphetamine addiction, organism-specific biosystem; Amphetamine addiction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.