Recombinant Human JUN

Cat.No. : JUN-27752TH
Product Overview : Recombinant fragment: MTAKMETTFY DDALNASFLP SESGPYGYSN PKILKQSMTL NLADPVGSLK PHLRAKNSDL LTSPDVGLLK LASPELERL, corresponding to N terminal amino acids 1-79 of Human c-Jun with N-terminal proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-79 a.a.
Description : This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Form : Liquid
Storage buffer : Preservative: NoneConstituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERL
Sequence Similarities : Belongs to the bZIP family. Jun subfamily.Contains 1 bZIP domain.
Gene Name JUN jun proto-oncogene [ Homo sapiens ]
Official Symbol JUN
Synonyms JUN; jun proto-oncogene; jun oncogene , v jun avian sarcoma virus 17 oncogene homolog , v jun sarcoma virus 17 oncogene homolog (avian); transcription factor AP-1; AP 1; c Jun;
Gene ID 3725
mRNA Refseq NM_002228
Protein Refseq NP_002219
MIM 165160
Uniprot ID P05412
Chromosome Location 1p32-p31
Pathway ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem;
Function DNA binding; R-SMAD binding; Rho GTPase activator activity; double-stranded DNA binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JUN Products

Required fields are marked with *

My Review for All JUN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon