Recombinant Human JUN
Cat.No. : | JUN-27752TH |
Product Overview : | Recombinant fragment: MTAKMETTFY DDALNASFLP SESGPYGYSN PKILKQSMTL NLADPVGSLK PHLRAKNSDL LTSPDVGLLK LASPELERL, corresponding to N terminal amino acids 1-79 of Human c-Jun with N-terminal proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-79 a.a. |
Description : | This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. |
Form : | Liquid |
Storage buffer : | Preservative: NoneConstituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5 |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERL |
Sequence Similarities : | Belongs to the bZIP family. Jun subfamily.Contains 1 bZIP domain. |
Gene Name | JUN jun proto-oncogene [ Homo sapiens ] |
Official Symbol | JUN |
Synonyms | JUN; jun proto-oncogene; jun oncogene , v jun avian sarcoma virus 17 oncogene homolog , v jun sarcoma virus 17 oncogene homolog (avian); transcription factor AP-1; AP 1; c Jun; |
Gene ID | 3725 |
mRNA Refseq | NM_002228 |
Protein Refseq | NP_002219 |
MIM | 165160 |
Uniprot ID | P05412 |
Chromosome Location | 1p32-p31 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; |
Function | DNA binding; R-SMAD binding; Rho GTPase activator activity; double-stranded DNA binding; protein binding; |
◆ Recombinant Proteins | ||
JUN-1499G | Recombinant Gallus gallus JUN Protein (Ser228-Gly298), N-His tagged | +Inquiry |
JUN-20H | Recombinant Human jun oncogene, His-tagged | +Inquiry |
JUN-10349Z | Recombinant Zebrafish JUN | +Inquiry |
JUN-792H | Recombinant Human Jun, His-tagged, 27.3 kDa (261 aa) | +Inquiry |
JUN-292H | Recombinant Human JUN protein, His/MBP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUN-5095HCL | Recombinant Human JUN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JUN Products
Required fields are marked with *
My Review for All JUN Products
Required fields are marked with *
0
Inquiry Basket