Recombinant Human KCNJ1

Cat.No. : KCNJ1-28453TH
Product Overview : Recombinant fragment of Human KCNJ1 with N terminal proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
Sequence Similarities : Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ1 subfamily.
Gene Name KCNJ1 potassium inwardly-rectifying channel, subfamily J, member 1 [ Homo sapiens ]
Official Symbol KCNJ1
Synonyms KCNJ1; potassium inwardly-rectifying channel, subfamily J, member 1; ATP-sensitive inward rectifier potassium channel 1; Kir1.1; ROMK1;
Gene ID 3758
mRNA Refseq NM_000220
Protein Refseq NP_000211
MIM 600359
Uniprot ID P48048
Chromosome Location 11q24
Pathway Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Inwardly rectifying K+ channels, organism-specific biosystem;
Function ATP binding; inward rectifier potassium channel activity; nucleotide binding; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNJ1 Products

Required fields are marked with *

My Review for All KCNJ1 Products

Required fields are marked with *

0
cart-icon