Recombinant Human KCNJ1 Protein (178-391 aa), His-tagged
Cat.No. : | KCNJ1-596H |
Product Overview : | Recombinant Human KCNJ1 Protein (178-391 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 178-391 aa |
Description : | In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 28.3 kDa |
AA Sequence : | ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | KCNJ1 potassium inwardly-rectifying channel, subfamily J, member 1 [ Homo sapiens ] |
Official Symbol | KCNJ1 |
Synonyms | KCNJ1; Kir1.1; ROMK1; ROMK; KIR1.1; |
Gene ID | 3758 |
mRNA Refseq | NM_000220 |
Protein Refseq | NP_000211 |
MIM | 600359 |
UniProt ID | P48048 |
◆ Recombinant Proteins | ||
KCNJ1-3194R | Recombinant Rat KCNJ1 Protein | +Inquiry |
KCNJ1-1431H | Recombinant Human KCNJ1 Protein (178-391 aa), His-tagged | +Inquiry |
RFL30716RF | Recombinant Full Length Rat Atp-Sensitive Inward Rectifier Potassium Channel 1(Kcnj1) Protein, His-Tagged | +Inquiry |
RFL22761HF | Recombinant Full Length Human Atp-Sensitive Inward Rectifier Potassium Channel 1(Kcnj1) Protein, His-Tagged | +Inquiry |
KCNJ1-28453TH | Recombinant Human KCNJ1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNJ1-5049HCL | Recombinant Human KCNJ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNJ1 Products
Required fields are marked with *
My Review for All KCNJ1 Products
Required fields are marked with *
0
Inquiry Basket