Recombinant Human KDM5A Protein (437-603 aa), His-SUMO-tagged
Cat.No. : | KDM5A-597H |
Product Overview : | Recombinant Human KDM5A Protein (437-603 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 437-603 aa |
Description : | Histone dethylase that specifically dethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not dethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Dethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12. Plays a role in the regulation of the circadian rhythm and in maintaining the normal periodicity of the circadian clock. In a histone dethylase-independent manner, acts as a coactivator of the CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER1/2 and other clock-controlled genes and increases histone acetylation at PER1/2 promoters by inhibiting the activity of HDAC1. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 35.3 kDa |
AA Sequence : | EYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | KDM5A lysine (K)-specific demethylase 5A [ Homo sapiens ] |
Official Symbol | KDM5A |
Synonyms | KDM5A; RBP2; RBBP2; RBBP-2; JARID1A; |
Gene ID | 5927 |
mRNA Refseq | NM_001042603 |
Protein Refseq | NP_001036068 |
MIM | 180202 |
UniProt ID | P29375 |
◆ Recombinant Proteins | ||
KDM5A-1432H | Recombinant Human KDM5A Protein (437-603 aa), His-tagged | +Inquiry |
KDM5A-43H | Active Recombinant Human KDM5A, FLAG-tagged | +Inquiry |
KDM5A-29894TH | Recombinant Human KDM5A | +Inquiry |
KDM5A-8594M | Recombinant Mouse KDM5A Protein | +Inquiry |
KDM5A-4782M | Recombinant Mouse KDM5A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM5A Products
Required fields are marked with *
My Review for All KDM5A Products
Required fields are marked with *
0
Inquiry Basket