Recombinant Human KDM5A
Cat.No. : | KDM5A-29894TH |
Product Overview : | Recombinant fragment of Human KDM5A / Jarid1A / RBBP2 with proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. |
Molecular Weight : | 36.630kDa inclusive of tags |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF |
Sequence Similarities : | Belongs to the JARID1 histone demethylase family.Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain.Contains 3 PHD-type zinc fingers. |
Gene Name | KDM5A lysine (K)-specific demethylase 5A [ Homo sapiens ] |
Official Symbol | KDM5A |
Synonyms | KDM5A; lysine (K)-specific demethylase 5A; JARID1A, jumonji, AT rich interactive domain 1A , Jumonji, AT rich interactive domain 1A (RBBP2 like) , RBBP2, retinoblastoma binding protein 2; lysine-specific demethylase 5A; |
Gene ID | 5927 |
mRNA Refseq | NM_001042603 |
Protein Refseq | NP_001036068 |
MIM | 180202 |
Uniprot ID | P29375 |
Chromosome Location | 12p11 |
Function | DNA binding; chromatin binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen in; |
◆ Recombinant Proteins | ||
KDM5A-4782M | Recombinant Mouse KDM5A Protein, His (Fc)-Avi-tagged | +Inquiry |
KDM5A-29894TH | Recombinant Human KDM5A | +Inquiry |
KDM5A-8594M | Recombinant Mouse KDM5A Protein | +Inquiry |
KDM5A-1432H | Recombinant Human KDM5A Protein (437-603 aa), His-tagged | +Inquiry |
KDM5A-43H | Active Recombinant Human KDM5A, FLAG-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KDM5A Products
Required fields are marked with *
My Review for All KDM5A Products
Required fields are marked with *
0
Inquiry Basket