Recombinant Human KDM5A

Cat.No. : KDM5A-29894TH
Product Overview : Recombinant fragment of Human KDM5A / Jarid1A / RBBP2 with proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein.
Molecular Weight : 36.630kDa inclusive of tags
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
Sequence Similarities : Belongs to the JARID1 histone demethylase family.Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain.Contains 3 PHD-type zinc fingers.
Gene Name KDM5A lysine (K)-specific demethylase 5A [ Homo sapiens ]
Official Symbol KDM5A
Synonyms KDM5A; lysine (K)-specific demethylase 5A; JARID1A, jumonji, AT rich interactive domain 1A , Jumonji, AT rich interactive domain 1A (RBBP2 like) , RBBP2, retinoblastoma binding protein 2; lysine-specific demethylase 5A;
Gene ID 5927
mRNA Refseq NM_001042603
Protein Refseq NP_001036068
MIM 180202
Uniprot ID P29375
Chromosome Location 12p11
Function DNA binding; chromatin binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen in;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDM5A Products

Required fields are marked with *

My Review for All KDM5A Products

Required fields are marked with *

0
cart-icon