Recombinant Human KIR2DL4 Protein, His-tagged
Cat.No. : | KIR2DL4-197H |
Product Overview : | Recombinant Human KIR2DL4, transcript variant 2, fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Molecular Mass : | 25.34kD |
AA Sequence : | WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | KIR2DL4 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 [ Homo sapiens ] |
Official Symbol | KIR2DL4 |
Synonyms | KIR2DL4; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4; killer cell immunoglobulin-like receptor 2DL4; 15.212; 103AS; CD158D; KIR-103AS; NK cell receptor; killer Ig receptor; CD158 antigen-like family member D; MHC class I NK cell receptor KIR103AS; killer cell inhibitory receptor 103AS; natural killer cell inhibitory receptor; G9P; KIR103; KIR103AS; |
Gene ID | 3805 |
mRNA Refseq | NM_001080770 |
Protein Refseq | NP_001074241 |
MIM | 604945 |
UniProt ID | Q99706 |
◆ Recombinant Proteins | ||
KIR2DL4-4341H | Recombinant Human KIR2DL4 Protein (Met1-His242), C-Fc tagged | +Inquiry |
KIR2DL4-083H | Recombinant Human KIR2DL4 Protein, C-His-tagged | +Inquiry |
KIR2DL4-197H | Recombinant Human KIR2DL4 Protein, His-tagged | +Inquiry |
KIR2DL4-0311H | Recombinant Human KIR2DL4 protein, hFc-tagged | +Inquiry |
KIR2DL4-338H | Recombinant Human KIR2DL4, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL4-002HCL | Recombinant Human KIR2DL4 cell lysate | +Inquiry |
KIR2DL4-001HCL | Recombinant Human KIR2DL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR2DL4 Products
Required fields are marked with *
My Review for All KIR2DL4 Products
Required fields are marked with *
0
Inquiry Basket