Recombinant Human KIR2DL4 Protein, His-tagged

Cat.No. : KIR2DL4-197H
Product Overview : Recombinant Human KIR2DL4, transcript variant 2, fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
Molecular Mass : 25.34kD
AA Sequence : WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name KIR2DL4 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 [ Homo sapiens ]
Official Symbol KIR2DL4
Synonyms KIR2DL4; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4; killer cell immunoglobulin-like receptor 2DL4; 15.212; 103AS; CD158D; KIR-103AS; NK cell receptor; killer Ig receptor; CD158 antigen-like family member D; MHC class I NK cell receptor KIR103AS; killer cell inhibitory receptor 103AS; natural killer cell inhibitory receptor; G9P; KIR103; KIR103AS;
Gene ID 3805
mRNA Refseq NM_001080770
Protein Refseq NP_001074241
MIM 604945
UniProt ID Q99706

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR2DL4 Products

Required fields are marked with *

My Review for All KIR2DL4 Products

Required fields are marked with *

0
cart-icon