Recombinant Human KIR2DL4 Protein, C-His-tagged
Cat.No. : | KIR2DL4-083H |
Product Overview : | Recombinant Human KIR2DL4 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory human killer cell immunoglobulin-like receptor 2DL4 (KIR2DL4), also referred to as 2DL4 or CD158d, triggers potent IFN-γ responses but weak cytotoxicity in resting NK cells because of the low stoichiometric association with γ |
Molecular Mass : | ~24 kDa |
AA Sequence : | WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KIR2DL4 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 [ Homo sapiens (human) ] |
Official Symbol | KIR2DL4 |
Synonyms | KIR2DL4; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4; killer cell immunoglobulin-like receptor 2DL4; 15.212; 103AS; CD158D; KIR-103AS; NK cell receptor; killer Ig receptor; CD158 antigen-like family member D; MHC class I NK cell receptor KIR103AS; killer cell inhibitory receptor 103AS; natural killer cell inhibitory receptor; G9P; KIR103; KIR103AS; |
Gene ID | 3805 |
mRNA Refseq | NM_001080770 |
Protein Refseq | NP_001074239 |
MIM | 604945 |
UniProt ID | Q99706 |
◆ Recombinant Proteins | ||
KIR2DL4-1941H | Recombinant Human KIR2DL4 protein, Fc-tagged | +Inquiry |
KIR2DL4-338H | Recombinant Human KIR2DL4, Fc tagged | +Inquiry |
KIR2DL4-147H | Recombinant Human KIR2DL4 | +Inquiry |
KIR2DL4-337H | Recombinant Human KIR2DL4, LEVLFQ tagged | +Inquiry |
KIR2DL4-2686H | Recombinant Human KIR2DL4 Protein (Trp22-His242), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL4-002HCL | Recombinant Human KIR2DL4 cell lysate | +Inquiry |
KIR2DL4-001HCL | Recombinant Human KIR2DL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIR2DL4 Products
Required fields are marked with *
My Review for All KIR2DL4 Products
Required fields are marked with *