Recombinant Human KIR2DL4 Protein, C-His-tagged

• Cat.No.: KIR2DL4-083H
• Product Overview: Recombinant Human KIR2DL4 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory human killer cell immunoglobulin-like receptor 2DL4 (KIR2DL4), also referred to as 2DL4 or CD158d, triggers potent IFN-γ responses but weak cytotoxicity in resting NK cells because of the low stoichiometric association with γ
• Molecular Mass: ~24 kDa
• AA Sequence: WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: KIR2DL4 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 [ Homo sapiens (human) ]
• Official Symbol: KIR2DL4
• Synonyms: KIR2DL4; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4; killer cell immunoglobulin-like receptor 2DL4; 15.212; 103AS; CD158D; KIR-103AS; NK cell receptor; killer Ig receptor; CD158 antigen-like family member D; MHC class I NK cell receptor KIR103AS; killer cell inhibitory receptor 103AS; natural killer cell inhibitory receptor; G9P; KIR103; KIR103AS
• Gene ID: 3805
• mRNA Refseq: NM_001080770
• Protein Refseq: NP_001074239
• MIM: 604945
• UniProt ID: Q99706