Recombinant Human KIR2DL4 Protein, C-His-tagged

Cat.No. : KIR2DL4-083H
Product Overview : Recombinant Human KIR2DL4 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory human killer cell immunoglobulin-like receptor 2DL4 (KIR2DL4), also referred to as 2DL4 or CD158d, triggers potent IFN-γ responses but weak cytotoxicity in resting NK cells because of the low stoichiometric association with γ
Molecular Mass : ~24 kDa
AA Sequence : WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name KIR2DL4 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 [ Homo sapiens (human) ]
Official Symbol KIR2DL4
Synonyms KIR2DL4; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4; killer cell immunoglobulin-like receptor 2DL4; 15.212; 103AS; CD158D; KIR-103AS; NK cell receptor; killer Ig receptor; CD158 antigen-like family member D; MHC class I NK cell receptor KIR103AS; killer cell inhibitory receptor 103AS; natural killer cell inhibitory receptor; G9P; KIR103; KIR103AS;
Gene ID 3805
mRNA Refseq NM_001080770
Protein Refseq NP_001074239
MIM 604945
UniProt ID Q99706

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR2DL4 Products

Required fields are marked with *

My Review for All KIR2DL4 Products

Required fields are marked with *

0
cart-icon
0
compare icon