Recombinant Human LDHA protein, His-tagged
Cat.No. : | LDHA-3157H |
Product Overview : | Recombinant Human LDHA protein(P00338)(5-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 5-323aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.1 kDa |
AA Sequence : | KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LDHA lactate dehydrogenase A [ Homo sapiens ] |
Official Symbol | LDHA |
Synonyms | LDHA; lactate dehydrogenase A; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; LDH1; LDHM; GSD11; PIG19; |
Gene ID | 3939 |
mRNA Refseq | NM_001135239 |
Protein Refseq | NP_001128711 |
MIM | 150000 |
UniProt ID | P00338 |
◆ Recombinant Proteins | ||
LDHA-261H | Recombinant Human LDHA, GST-tagged | +Inquiry |
LDHA-3158H | Recombinant Human LDHA protein | +Inquiry |
LDHA-0136H | Recombinant Human LDHA Protein (A2-F332), His tagged | +Inquiry |
Ldha-5712M | Recombinant Mouse Ldha Protein (Met1-Phe332), C-His tagged | +Inquiry |
LDHA-1944H | Recombinant Human Lactate dehydrogenase A, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LDHA Products
Required fields are marked with *
My Review for All LDHA Products
Required fields are marked with *
0
Inquiry Basket