Recombinant Human LDHA protein
| Cat.No. : | LDHA-3158H |
| Product Overview : | Recombinant Human LDHA protein(P00338)(5-323aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 5-323aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.1 kDa |
| AA Sequence : | KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | LDHA lactate dehydrogenase A [ Homo sapiens ] |
| Official Symbol | LDHA |
| Synonyms | LDHA; lactate dehydrogenase A; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; LDH1; LDHM; GSD11; PIG19; |
| Gene ID | 3939 |
| mRNA Refseq | NM_001135239 |
| Protein Refseq | NP_001128711 |
| MIM | 150000 |
| UniProt ID | P00338 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHA Products
Required fields are marked with *
My Review for All LDHA Products
Required fields are marked with *



