Recombinant Human LDHA protein, GST-tagged
Cat.No. : | LDHA-30120H |
Product Overview : | Recombinant Human LDHA (283-332 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile283-Phe332 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LDHA lactate dehydrogenase A [ Homo sapiens ] |
Official Symbol | LDHA |
Synonyms | LDHA; lactate dehydrogenase A; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; LDH1; LDHM; GSD11; PIG19; |
Gene ID | 3939 |
mRNA Refseq | NM_001135239 |
Protein Refseq | NP_001128711 |
MIM | 150000 |
UniProt ID | P00338 |
◆ Recombinant Proteins | ||
LDHA-3157H | Recombinant Human LDHA protein, His-tagged | +Inquiry |
Ldha-1305M | Recombinant Mouse Ldha Protein, MYC/DDK-tagged | +Inquiry |
LDHA-2307R | Recombinant Rhesus Macaque LDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHA-262H | Active Recombinant Human LDHA Protein, MYC/DDK-tagged | +Inquiry |
Ldha-7252M | Active Recombinant Mouse Ldha Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LDHA Products
Required fields are marked with *
My Review for All LDHA Products
Required fields are marked with *
0
Inquiry Basket