Recombinant Human MDC1 Protein (1892-2082 aa), His-SUMO-tagged

Cat.No. : MDC1-2343H
Product Overview : Recombinant Human MDC1 Protein (1892-2082 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1892-2082 aa
Description : Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 36.9 kDa
AA Sequence : APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name MDC1 mediator of DNA-damage checkpoint 1 [ Homo sapiens ]
Official Symbol MDC1
Synonyms MDC1; Em:AB023051.5; KIAA0170; NFBD1; nuclear factor with BRCT domains 1; MGC166888; DKFZp781A0122;
Gene ID 9656
mRNA Refseq NM_014641
Protein Refseq NP_055456
MIM 607593
UniProt ID Q14676

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDC1 Products

Required fields are marked with *

My Review for All MDC1 Products

Required fields are marked with *

0
cart-icon