Recombinant Human MDC1 Protein (1892-2082 aa), His-tagged
Cat.No. : | MDC1-2039H |
Product Overview : | Recombinant Human MDC1 Protein (1892-2082 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1892-2082 aa |
Description : | Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.9 kDa |
AA Sequence : | APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | MDC1 mediator of DNA-damage checkpoint 1 [ Homo sapiens ] |
Official Symbol | MDC1 |
Synonyms | MDC1; Em:AB023051.5; KIAA0170; NFBD1; MGC166888; DKFZp781A0122; |
Gene ID | 9656 |
mRNA Refseq | NM_014641 |
Protein Refseq | NP_055456 |
MIM | 607593 |
UniProt ID | Q14676 |
◆ Recombinant Proteins | ||
MDC1-2039H | Recombinant Human MDC1 Protein (1892-2082 aa), His-tagged | +Inquiry |
MDC1-3626R | Recombinant Rat MDC1 Protein | +Inquiry |
MDC1-2343H | Recombinant Human MDC1 Protein (1892-2082 aa), His-SUMO-tagged | +Inquiry |
MDC1-2709R | Recombinant Rhesus monkey MDC1 Protein, His-tagged | +Inquiry |
MDC1-2529R | Recombinant Rhesus Macaque MDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDC1 Products
Required fields are marked with *
My Review for All MDC1 Products
Required fields are marked with *
0
Inquiry Basket