Recombinant Human MIF Protein (115 aa)

Cat.No. : MIF-332M
Product Overview : Recombinant human Macrophage Migration Inhibitory Factor (rhMIF) produced in E. coli is a single non-glycosylated polypeptide chain containing 115 amino acids. rhMIF has a molecular mass of 12.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 115
Description : Macrophage Migration Inhibitory Factor (MIF) is a pleiotropic cytokine, existing as a homotrimer in vivo. MIF was originally identified as a T cell derived factor responsible for the inhibition of macrophage migration. However, recently MIF has received much more attention because of its possible roles in angiogenesis and cancer development. MIF is over-expressed in various cancers, including pancreatic, breast, colon, brain, prostate, skin, and lung. The intratumoral expression of MIF is strongly correlated with angiogenic growth factor expression, such as the expression of Interleukin 8 (IL-8) and Vascular Endothelial Growth Factor (VEGF), and with risk of recurrence after resection.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Molecular Mass : 12.5 kDa, observed by reducing SDS-PAGE.
AA Sequence : MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Macrophage Migration Inhibitory Factor (rhMIF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhMIF remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ]
Official Symbol MIF
Synonyms MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF;
Gene ID 4282
mRNA Refseq NM_002415
Protein Refseq NP_002406
MIM 153620
UniProt ID P14174

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIF Products

Required fields are marked with *

My Review for All MIF Products

Required fields are marked with *

0
cart-icon