Recombinant Human MIF Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MIF-4681H |
| Product Overview : | MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. |
| Molecular Mass : | 12.5 kDa |
| AA Sequence : | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MIF macrophage migration inhibitory factor [ Homo sapiens (human) ] |
| Official Symbol | MIF |
| Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
| Gene ID | 4282 |
| mRNA Refseq | NM_002415 |
| Protein Refseq | NP_002406 |
| MIM | 153620 |
| UniProt ID | P14174 |
| ◆ Recombinant Proteins | ||
| MIF-736H | Active Recombinant Human MIF Protein, His-tagged | +Inquiry |
| Mif-4001M | Recombinant Mouse Mif protein, His-tagged | +Inquiry |
| Mif-5465M | Recombinant Mouse Mif protein, His-tagged | +Inquiry |
| MIF-23H | Recombinant Human MIF protein, His-tagged | +Inquiry |
| MIF-3816H | Recombinant Human MIF protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
| MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *
