Recombinant Human MIF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MIF-4681H |
Product Overview : | MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. |
Molecular Mass : | 12.5 kDa |
AA Sequence : | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MIF macrophage migration inhibitory factor [ Homo sapiens (human) ] |
Official Symbol | MIF |
Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
Gene ID | 4282 |
mRNA Refseq | NM_002415 |
Protein Refseq | NP_002406 |
MIM | 153620 |
UniProt ID | P14174 |
◆ Recombinant Proteins | ||
MIF-2772R | Recombinant Rhesus monkey MIF Protein, His-tagged | +Inquiry |
Mif-7286M | Recombinant Mouse Mif Protein, His-tagged | +Inquiry |
MIF-277H | Recombinant Human MIF | +Inquiry |
MIF-650H | Active Recombinant Human MIF, His-tagged | +Inquiry |
MIF-694C | Recombinant Cynomolgus MIF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *