Recombinant Human MLKL, GST-tagged
Cat.No. : | MLKL-95H |
Product Overview : | Recombinant Human MLKL(1 a.a. - 471 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Molecular Mass : | 80.9 kDa |
AA Sequence : | MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGE IEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQM LRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRA PVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMSLGTTREKTDRVKSTA YLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRA HDPSVRPSVDEILKKLSTFSK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLKL mixed lineage kinase domain-like [ Homo sapiens ] |
Official Symbol | MLKL |
Synonyms | MLKL; mixed lineage kinase domain-like; mixed lineage kinase domain-like protein; hMLKL |
Gene ID | 197259 |
mRNA Refseq | NM_152649 |
Protein Refseq | NP_689862 |
MIM | 615153 |
UniProt ID | Q8NB16 |
Chromosome Location | 16q23.1 |
Pathway | DNA damage response (only ATM dependent); TNF signaling pathway |
Function | ATP binding; protein binding; protein complex binding |
◆ Recombinant Proteins | ||
MLKL-4074H | Recombinant Human MLKL Protein (Met1-Leu263), N-His tagged | +Inquiry |
MLKL-6980HF | Recombinant Full Length Human MLKL Protein, GST-tagged | +Inquiry |
MLKL-0925H | Recombinant Human MLKL Protein (E2-K471), Tag Free | +Inquiry |
MLKL-905H | Recombinant Human MLKL, GST-tagged | +Inquiry |
MLKL-1706M | Recombinant Mouse MLKL Protein (1-472 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLKL-1115HCL | Recombinant Human MLKL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLKL Products
Required fields are marked with *
My Review for All MLKL Products
Required fields are marked with *