Recombinant Full Length Human MLKL Protein, GST-tagged
Cat.No. : | MLKL-6980HF |
Product Overview : | Recombinant Human full-length MLKL(1 a.a. - 471 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 471 amino acids |
Description : | This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to be inactive because it lacks several residues required for activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in necroptosis pathway. Inhibitor studies and knockdown of this gene inhibited TNF-induced necrosis. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children. Alternatively spliced transcript variants have been described for this gene. |
Molecular Mass : | 80.9 kDa |
AA Sequence : | MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGE IEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQM LRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRA PVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMSLGTTREKTDRVKSTA YLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRA HDPSVRPSVDEILKKLSTFSK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Gene Name | MLKL mixed lineage kinase domain-like [ Homo sapiens ] |
Official Symbol | MLKL |
Synonyms | MLKL; mixed lineage kinase domain-like; mixed lineage kinase domain-like protein; hMLKL |
Gene ID | 197259 |
mRNA Refseq | NM_152649 |
Protein Refseq | NP_689862 |
MIM | 615153 |
UniProt ID | Q8NB16 |
◆ Recombinant Proteins | ||
MLKL-0926H | Recombinant Human MLKL Protein (E2-K471), His/GST tagged | +Inquiry |
MLKL-1706M | Recombinant Mouse MLKL Protein (1-472 aa), His-tagged | +Inquiry |
MLKL-905H | Recombinant Human MLKL, GST-tagged | +Inquiry |
MLKL-4074H | Recombinant Human MLKL Protein (Met1-Leu263), N-His tagged | +Inquiry |
MLKL-0925H | Recombinant Human MLKL Protein (E2-K471), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLKL-1115HCL | Recombinant Human MLKL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLKL Products
Required fields are marked with *
My Review for All MLKL Products
Required fields are marked with *
0
Inquiry Basket