Recombinant Mouse MLKL Protein (1-472 aa), His-tagged

Cat.No. : MLKL-1706M
Product Overview : Recombinant Mouse MLKL Protein (1-472 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 1-472 aa
Description : Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process. Activated following phosphorylation by RIPK3, leading to homotrimerization, localization to the plasma mbrane and execution of programmed necrosis characterized by calcium influx and plasma mbrane damage. Does not have protein kinase activity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 56.3 kDa
AA Sequence : MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGRSLSGRERILERLSAVEESTDKKV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Mlkl mixed lineage kinase domain-like [ Mus musculus ]
Official Symbol MLKL
Synonyms MLKL; mixed lineage kinase domain-like; 9130019I15Rik;
Gene ID 74568
mRNA Refseq NM_029005
Protein Refseq NP_083281
UniProt ID Q9D2Y4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLKL Products

Required fields are marked with *

My Review for All MLKL Products

Required fields are marked with *

0
cart-icon