Recombinant Human MPZ Protein, GST-tagged

Cat.No. : MPZ-5524H
Product Overview : Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 as other polyneuropathies. [provided by RefSeq
Molecular Mass : 54.12 kDa
AA Sequence : MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPZ myelin protein zero [ Homo sapiens ]
Official Symbol MPZ
Synonyms MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; myelin peripheral protein; Charcot-Marie-Tooth neuropathy 1B; P0; CHM; DSS; MPP; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3;
Gene ID 4359
mRNA Refseq NM_000530
Protein Refseq NP_000521
MIM 159440
UniProt ID P25189

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPZ Products

Required fields are marked with *

My Review for All MPZ Products

Required fields are marked with *

0
cart-icon