Recombinant Full Length Human MPZ Protein, GST-tagged

• Cat.No.: MPZ-6337HF
• Product Overview: Human MPZ full-length ORF ( AAH06491.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 258 amino acids
• Description: This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 as other polyneuropathies. [provided by RefSeq
• Molecular Mass: 54.12 kDa
• AA Sequence: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPZ myelin protein zero [ Homo sapiens ]
• Official Symbol: MPZ
• Synonyms: MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; myelin peripheral protein; Charcot-Marie-Tooth neuropathy 1B; P0; CHM; DSS; MPP; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3
• Gene ID: 4359
• mRNA Refseq: NM_000530
• Protein Refseq: NP_000521
• MIM: 159440
• UniProt ID: P25189