Recombinant Human MPZ protein, His-tagged
Cat.No. : | MPZ-3239H |
Product Overview : | Recombinant Human MPZ protein(P25189)(30-156aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-156aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.5 kDa |
AA Sequence : | IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MPZ myelin protein zero [ Homo sapiens ] |
Official Symbol | MPZ |
Synonyms | MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; myelin peripheral protein; Charcot-Marie-Tooth neuropathy 1B; P0; CHM; DSS; MPP; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; |
Gene ID | 4359 |
mRNA Refseq | NM_000530 |
Protein Refseq | NP_000521 |
MIM | 159440 |
UniProt ID | P25189 |
◆ Recombinant Proteins | ||
MPZ-29152TH | Recombinant Human MPZ | +Inquiry |
MPZ-3902H | Recombinant Human MPZ protein, MYC/DDK-tagged | +Inquiry |
MPZ-1218H | Recombinant Human MPZ Protein (30-156 aa), GST-tagged | +Inquiry |
MPZ-4600H | Recombinant Human MPZ Protein (Ile30-Lys248), His tagged | +Inquiry |
MPZ-3744R | Recombinant Rat MPZ Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *
0
Inquiry Basket