Recombinant Human MPZ Protein (30-156 aa), His-tagged
| Cat.No. : | MPZ-1461H |
| Product Overview : | Recombinant Human MPZ Protein (30-156 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 30-156 aa |
| Description : | Creation of an Extracellular domain mbrane face which guides the wrapping process and ultimately compacts adjacent lamellae. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 16.5 kDa |
| AA Sequence : | IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | MPZ myelin protein zero [ Homo sapiens ] |
| Official Symbol | MPZ |
| Synonyms | MPZ; HMSNIB; P0; CHM; DSS; MPP; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; |
| Gene ID | 4359 |
| mRNA Refseq | NM_000530 |
| Protein Refseq | NP_000521 |
| MIM | 159440 |
| UniProt ID | P25189 |
| ◆ Recombinant Proteins | ||
| MPZ-4600H | Recombinant Human MPZ Protein (Ile30-Lys248), His tagged | +Inquiry |
| MPZ-29152TH | Recombinant Human MPZ | +Inquiry |
| MPZ-3902H | Recombinant Human MPZ protein, MYC/DDK-tagged | +Inquiry |
| MPZ-3744R | Recombinant Rat MPZ Protein | +Inquiry |
| MPZ-3402R | Recombinant Rat MPZ Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *
