Recombinant Human MT2A protein, GST-tagged
Cat.No. : | MT2A-1070H |
Product Overview : | Recombinant Human MT2A protein(1-61 aa), fused with GST tag, was expressed in E.coli. |
Availability | August 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-61 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MT2A metallothionein 2A [ Homo sapiens ] |
Official Symbol | MT2A |
Synonyms | MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II; |
Gene ID | 4502 |
mRNA Refseq | NM_005953 |
Protein Refseq | NP_005944 |
MIM | 156360 |
UniProt ID | P02795 |
◆ Recombinant Proteins | ||
MT2A-319HF | Recombinant Full Length Human MT2A Protein, GST-tagged | +Inquiry |
MT2A-1200HFL | Recombinant Full Length Human MT2A Protein, C-Flag-tagged | +Inquiry |
MT2A-3250H | Recombinant Human MT2A protein, GST-tagged | +Inquiry |
MT2A-1446H | Recombinant Human MT2A Protein, His (Fc)-Avi-tagged | +Inquiry |
MT2A-1464H | Recombinant Human MT2A Protein (1-59 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT2A Products
Required fields are marked with *
My Review for All MT2A Products
Required fields are marked with *