Recombinant Human MT2A protein, GST-tagged

• Cat.No.: MT2A-1070H
• Product Overview: Recombinant Human MT2A protein(1-61 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-61 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MT2A metallothionein 2A [ Homo sapiens ]
• Official Symbol: MT2A
• Synonyms: MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II
• Gene ID: 4502
• mRNA Refseq: NM_005953
• Protein Refseq: NP_005944
• MIM: 156360
• UniProt ID: P02795