Recombinant Human MT2A, GST-tagged

• Cat.No.: MT2A-130H
• Product Overview: Recombinant Human MT2A(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Metallothionein-2 is a protein that in humans is encoded by the MT2A gene.
• Molecular Mass: 32.4 kDa
• AA Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MT2A metallothionein 2A [ Homo sapiens (human) ]
• Official Symbol: MT2A
• Synonyms: MT2A; MT2; metallothionein 2A; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II
• Gene ID: 4502
• mRNA Refseq: NM_005953
• Protein Refseq: NP_005944
• MIM: 156360
• UniProt ID: P02795
• Chromosome Location: 16q13
• Pathway: Cytokine Signaling in Immune system; Immune System; Interferon Signaling; Interferon gamma signaling; Mineral absorption
• Function: drug binding; protein binding; zinc ion binding