Recombinant Human NCEH1 Protein, GST-tagged
Cat.No. : | NCEH1-012H |
Product Overview : | Human AADACL1 full-length ORF ( AAH47588, 1 a.a. - 408 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NCEH1 (Neutral Cholesterol Ester Hydrolase 1) is a Protein Coding gene. Among its related pathways are Metabolism and Lipoprotein metabolism. GO annotations related to this gene include hydrolase activity and phosphate ion binding. An important paralog of this gene is AADAC. |
Molecular Mass : | 70.62 kDa |
AA Sequence : | MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NCEH1 neutral cholesterol ester hydrolase 1 [ Homo sapiens ] |
Official Symbol | NCEH1 |
Synonyms | NCEH1; neutral cholesterol ester hydrolase 1; AADACL1, arylacetamide deacetylase like 1; KIAA1363; NCEH; arylacetamide deacetylase-like 1; AADACL1; |
Gene ID | 57552 |
mRNA Refseq | NM_001146276 |
Protein Refseq | NP_001139748 |
MIM | 613234 |
UniProt ID | Q6PIU2 |
◆ Recombinant Proteins | ||
NCEH1-10466M | Recombinant Mouse NCEH1 Protein | +Inquiry |
RFL-4273RF | Recombinant Full Length Rat Neutral Cholesterol Ester Hydrolase 1(Nceh1) Protein, His-Tagged | +Inquiry |
NCEH1-5936M | Recombinant Mouse NCEH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCEH1-3577R | Recombinant Rat NCEH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCEH1-012H | Recombinant Human NCEH1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCEH1-3951HCL | Recombinant Human NCEH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCEH1 Products
Required fields are marked with *
My Review for All NCEH1 Products
Required fields are marked with *
0
Inquiry Basket