Recombinant Human NCEH1 Protein, GST-tagged

Cat.No. : NCEH1-012H
Product Overview : Human AADACL1 full-length ORF ( AAH47588, 1 a.a. - 408 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NCEH1 (Neutral Cholesterol Ester Hydrolase 1) is a Protein Coding gene. Among its related pathways are Metabolism and Lipoprotein metabolism. GO annotations related to this gene include hydrolase activity and phosphate ion binding. An important paralog of this gene is AADAC.
Molecular Mass : 70.62 kDa
AA Sequence : MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NCEH1 neutral cholesterol ester hydrolase 1 [ Homo sapiens ]
Official Symbol NCEH1
Synonyms NCEH1; neutral cholesterol ester hydrolase 1; AADACL1, arylacetamide deacetylase like 1; KIAA1363; NCEH; arylacetamide deacetylase-like 1; AADACL1;
Gene ID 57552
mRNA Refseq NM_001146276
Protein Refseq NP_001139748
MIM 613234
UniProt ID Q6PIU2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCEH1 Products

Required fields are marked with *

My Review for All NCEH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon