Recombinant Human NCF4
Cat.No. : | NCF4-29348TH |
Product Overview : | Recombinant full length human NCF4 produced in Saccharomyces cerevisiae; amino acids 1-339 , 39kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-339 a.a. |
Description : | The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Tissue specificity : | Expression is restricted to hematopoietic cells. |
Form : | Liquid |
Purity : | Immunogen affinity purified |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFV FVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSS ALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSV SPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLL SRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLF PWKLHITQKDNYRVYNTMP |
Sequence Similarities : | Contains 1 PX (phox homology) domain.Contains 1 SH3 domain. |
Full Length : | Full L. |
Gene Name | NCF4 neutrophil cytosolic factor 4, 40kDa [ Homo sapiens ] |
Official Symbol | NCF4 |
Synonyms | NCF4; neutrophil cytosolic factor 4, 40kDa; neutrophil cytosolic factor 4 (40kD); neutrophil cytosol factor 4; neutrophil NADPH oxidase factor 4; p40phox; SH3PXD4; |
Gene ID | 4689 |
mRNA Refseq | NM_000631 |
Protein Refseq | NP_000622 |
MIM | 601488 |
Uniprot ID | Q15080 |
Chromosome Location | 22q13.1 |
Pathway | Leishmaniasis, organism-specific biosystem; Leishmaniasis, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Osteoclast differentiation, organism-specific biosystem; |
Function | phosphatidylinositol binding; protein binding; protein dimerization activity; |
◆ Recombinant Proteins | ||
NCF4-10469M | Recombinant Mouse NCF4 Protein | +Inquiry |
NCF4-3336C | Recombinant Chicken NCF4 | +Inquiry |
NCF4-180H | Recombinant Human NCF4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NCF4-2953H | Recombinant Human Neutrophil Cytosolic Factor 4, 40kDa, T7-tagged | +Inquiry |
NCF4-519H | Recombinant Human NCF4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCF4-3949HCL | Recombinant Human NCF4 293 Cell Lysate | +Inquiry |
NCF4-3948HCL | Recombinant Human NCF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCF4 Products
Required fields are marked with *
My Review for All NCF4 Products
Required fields are marked with *
0
Inquiry Basket