Recombinant Human NFYA Protein, GST-tagged

Cat.No. : NFYA-201H
Product Overview : Recombinant Human NFYA, transcript variant 2, fused with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Molecular Mass : 60.58kD
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMEQYTANSNSSTEQIVVQAGQIQQQV
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name NFYA nuclear transcription factor Y, alpha [ Homo sapiens ]
Official Symbol NFYA
Synonyms NFYA; nuclear transcription factor Y, alpha; nuclear transcription factor Y subunit alpha; CBF B; HAP2; NF YA; HAP2 CCAAT-binding protein; Transcription factor NF-Y, A subunit; CAAT box DNA-binding protein subunit A; CAAT-box DNA binding protein subunit A; nuclear transcription factor Y subunit A; CCAAT-binding transcription factor subunit B; CBF-A; CBF-B; NF-YA; FLJ11236;
Gene ID 4800
mRNA Refseq M_021705
Protein Refseq NP_068351
MIM 189903
UniProt ID P23511

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFYA Products

Required fields are marked with *

My Review for All NFYA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon