Recombinant Human NFYA Protein, GST-tagged
Cat.No. : | NFYA-201H |
Product Overview : | Recombinant Human NFYA, transcript variant 2, fused with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Molecular Mass : | 60.58kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMEQYTANSNSSTEQIVVQAGQIQQQV |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | NFYA nuclear transcription factor Y, alpha [ Homo sapiens ] |
Official Symbol | NFYA |
Synonyms | NFYA; nuclear transcription factor Y, alpha; nuclear transcription factor Y subunit alpha; CBF B; HAP2; NF YA; HAP2 CCAAT-binding protein; Transcription factor NF-Y, A subunit; CAAT box DNA-binding protein subunit A; CAAT-box DNA binding protein subunit A; nuclear transcription factor Y subunit A; CCAAT-binding transcription factor subunit B; CBF-A; CBF-B; NF-YA; FLJ11236; |
Gene ID | 4800 |
mRNA Refseq | M_021705 |
Protein Refseq | NP_068351 |
MIM | 189903 |
UniProt ID | P23511 |
◆ Recombinant Proteins | ||
NFYA-379H | Recombinant Human NFYA | +Inquiry |
NFYA-1285H | Recombinant Human NFYA, GST-tagged | +Inquiry |
NFYA-4699H | Recombinant Human NFYA Protein (Met1-Ser318) | +Inquiry |
NFYA-3977R | Recombinant Rat NFYA Protein | +Inquiry |
NFYA-5207Z | Recombinant Zebrafish NFYA | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFYA-3841HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
NFYA-3840HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFYA Products
Required fields are marked with *
My Review for All NFYA Products
Required fields are marked with *
0
Inquiry Basket