Recombinant Human NFYA
Cat.No. : | NFYA-30385TH |
Product Overview : | Recombinant fragment of Human NFYA Isoform short with N-terminal proprietary tag. Mol Wt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS* |
Gene Name | NFYA nuclear transcription factor Y, alpha [ Homo sapiens ] |
Official Symbol | NFYA |
Synonyms | NFYA; nuclear transcription factor Y, alpha; nuclear transcription factor Y subunit alpha; CBF B; HAP2; NF YA; |
Gene ID | 4800 |
mRNA Refseq | NM_002505 |
Protein Refseq | NP_002496 |
MIM | 189903 |
Uniprot ID | P23511 |
Chromosome Location | 6p21.3 |
Pathway | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
NFYA-1470C | Recombinant Chicken NFYA | +Inquiry |
NFYA-4698H | Recombinant Human NFYA Protein (Met1-Ser318), N-Gst tagged | +Inquiry |
NFYA-3636R | Recombinant Rat NFYA Protein, His (Fc)-Avi-tagged | +Inquiry |
NFYA-203H | Recombinant Human NFYA Protein, His-tagged | +Inquiry |
NFYA-379H | Recombinant Human NFYA | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFYA-3841HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
NFYA-3840HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFYA Products
Required fields are marked with *
My Review for All NFYA Products
Required fields are marked with *
0
Inquiry Basket