Recombinant Human NFYA
| Cat.No. : | NFYA-30385TH |
| Product Overview : | Recombinant fragment of Human NFYA Isoform short with N-terminal proprietary tag. Mol Wt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS* |
| Gene Name | NFYA nuclear transcription factor Y, alpha [ Homo sapiens ] |
| Official Symbol | NFYA |
| Synonyms | NFYA; nuclear transcription factor Y, alpha; nuclear transcription factor Y subunit alpha; CBF B; HAP2; NF YA; |
| Gene ID | 4800 |
| mRNA Refseq | NM_002505 |
| Protein Refseq | NP_002496 |
| MIM | 189903 |
| Uniprot ID | P23511 |
| Chromosome Location | 6p21.3 |
| Pathway | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; |
| Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| NFYA-1470C | Recombinant Chicken NFYA | +Inquiry |
| NFYA-3636R | Recombinant Rat NFYA Protein, His (Fc)-Avi-tagged | +Inquiry |
| NFYA-4699H | Recombinant Human NFYA Protein (Met1-Ser318) | +Inquiry |
| NFYA-200H | Recombinant Human NFYA Protein, His-tagged | +Inquiry |
| NFYA-201H | Recombinant Human NFYA Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFYA-3841HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
| NFYA-3840HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFYA Products
Required fields are marked with *
My Review for All NFYA Products
Required fields are marked with *
