Recombinant Human NFYA

Cat.No. : NFYA-30385TH
Product Overview : Recombinant fragment of Human NFYA Isoform short with N-terminal proprietary tag. Mol Wt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS*
Gene Name NFYA nuclear transcription factor Y, alpha [ Homo sapiens ]
Official Symbol NFYA
Synonyms NFYA; nuclear transcription factor Y, alpha; nuclear transcription factor Y subunit alpha; CBF B; HAP2; NF YA;
Gene ID 4800
mRNA Refseq NM_002505
Protein Refseq NP_002496
MIM 189903
Uniprot ID P23511
Chromosome Location 6p21.3
Pathway Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem;
Function DNA binding; protein binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFYA Products

Required fields are marked with *

My Review for All NFYA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon