Recombinant Human NIPSNAP1 Protein, GST-tagged
Cat.No. : | NIPSNAP1-5874H |
Product Overview : | Human NIPSNAP1 full-length ORF ( AAH02371.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NIPSNAP1 protein has a strong sequence similarity to the central portion of a hypothetical protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. The NIPSNAP1 gene is located between the NF2 and pK1.3 genes on 22q12. [provided by RefSeq |
Molecular Mass : | 59.7 kDa |
AA Sequence : | MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NIPSNAP1 nipsnap homolog 1 (C. elegans) [ Homo sapiens ] |
Official Symbol | NIPSNAP1 |
Synonyms | NIPSNAP1; nipsnap homolog 1 (C. elegans); protein NipSnap homolog 1; 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1; |
Gene ID | 8508 |
mRNA Refseq | NM_001202502 |
Protein Refseq | NP_001189431 |
◆ Recombinant Proteins | ||
NIPSNAP1-4906C | Recombinant Chicken NIPSNAP1 | +Inquiry |
NIPSNAP1-8662Z | Recombinant Zebrafish NIPSNAP1 | +Inquiry |
NIPSNAP1-5874H | Recombinant Human NIPSNAP1 Protein, GST-tagged | +Inquiry |
NIPSNAP1-6636HF | Recombinant Full Length Human NIPSNAP1 Protein, GST-tagged | +Inquiry |
NIPSNAP1-10677M | Recombinant Mouse NIPSNAP1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NIPSNAP1 Products
Required fields are marked with *
My Review for All NIPSNAP1 Products
Required fields are marked with *
0
Inquiry Basket