Recombinant Full Length Human NIPSNAP1 Protein, GST-tagged
| Cat.No. : | NIPSNAP1-6636HF |
| Product Overview : | Human NIPSNAP1 full-length ORF ( AAH02371.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 284 amino acids |
| Description : | NIPSNAP1 protein has a strong sequence similarity to the central portion of a hypothetical protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. The NIPSNAP1 gene is located between the NF2 and pK1.3 genes on 22q12. [provided by RefSeq |
| Molecular Mass : | 59.7 kDa |
| AA Sequence : | MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NIPSNAP1 nipsnap homolog 1 (C. elegans) [ Homo sapiens ] |
| Official Symbol | NIPSNAP1 |
| Synonyms | NIPSNAP1; nipsnap homolog 1 (C. elegans); protein NipSnap homolog 1; 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1; |
| Gene ID | 8508 |
| mRNA Refseq | NM_001202502 |
| Protein Refseq | NP_001189431 |
| MIM | 603249 |
| UniProt ID | Q9BPW8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIPSNAP1 Products
Required fields are marked with *
My Review for All NIPSNAP1 Products
Required fields are marked with *
